Loading...
Statistics
CROTON MANOR
www.crotonmanor.com/
CROTON MANOR is a 6 bed Assisted Living Facility In Sarasota, FL with rooms start as low as
Crotonmanor.com
Crotonmanor.com is hosted in
United States
/
San Jose
.
Crotonmanor.com doesn't use HTTPS protocol.
Number of used technologies:
8.
First technologies:
CSS, Google Font API, Html,
Number of used javascripts: 9.
First javascripts:
Html5.js, Adsbygoogle.js, Jquery.js,
Number of used analytics tools:
0.
Its server type is:
squid/3.5.19.
Technologies in use by Crotonmanor.com
Technology
Number of occurences: 8
- CSS
- Google Font API
- Html
- Html5
- Iframe
- Javascript
- jQuery
- jQuery Validate
Advertisement
Javascripts
Number of occurences: 9
- html5.js
- adsbygoogle.js
- jquery.js
- jquery.validate.min.js
- bootstrap.min.js
- respond.js
- jquery.bxslider.min.js
- tabs.js
- jquery.nouislider.min.js
Advertise
Number of occurences: 1
- Google Adsense
Server Type
- squid/3.5.19
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Crotonmanor.com
Missing HTTPS protocol.
Number of occurences: 5
- Name:
Content: text/html; charset=utf-8 - Name: description
Content: CROTON MANOR is a 6 bed Assisted Living Facility In Sarasota, FL with rooms start as low as - Name: keywords
Content: CROTON MANOR, Assisted Living Sarasota FL, Elder Care Sarasota FL, Senior Housing Sarasota FL, Board And Care Homes Sarasota FL - Name: author
Content: - Name: viewport
Content: width=device-width, initial-scale=1.0
Server / Hosting
- IP: 52.8.86.201
- Latitude: 37.34
- Longitude: -121.89
- Country: United States
- City: San Jose
Rname
- pdns05.domaincontrol.com
- pdns06.domaincontrol.com
Target
- dns.jomax.net
HTTP Header Response
HTTP/1.1 503 Service Unavailable
Server: squid/3.5.19
Mime-Version: 1.0
Date: Wed, 08 Jun 2016 16:02:41 GMT
Content-Type: text/html;charset=utf-8
Content-Length: 3738
X-Squid-Error: ERR_DNS_FAIL 0
X-Cache: MISS from s_bd39
X-Cache-Lookup: MISS from s_bd39:80
Via: 1.1 s_bd39 (squid/3.5.19)
Connection: keep-alive
DNS
host: crotonmanor.com
- class: IN
- ttl: 3600
- type: NS
- target: pdns05.domaincontrol.com
host: crotonmanor.com
- class: IN
- ttl: 3600
- type: NS
- target: pdns06.domaincontrol.com
host: crotonmanor.com
- class: IN
- ttl: 3600
- type: SOA
- mname: pdns05.domaincontrol.com
- rname: dns.jomax.net
- serial: 2016050200
- refresh: 28800
- retry: 7200
- expire: 604800
- minimum-ttl: 86400
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.rotonmanor.com, www.cdrotonmanor.com, www.drotonmanor.com, www.crrotonmanor.com, www.rrotonmanor.com, www.ctrotonmanor.com, www.trotonmanor.com, www.cvrotonmanor.com, www.vrotonmanor.com, www.cfrotonmanor.com, www.frotonmanor.com, www.cgrotonmanor.com, www.grotonmanor.com, www.chrotonmanor.com, www.hrotonmanor.com, www.cnrotonmanor.com, www.nrotonmanor.com, www.cmrotonmanor.com, www.mrotonmanor.com, www.cjrotonmanor.com, www.jrotonmanor.com, www.cotonmanor.com, www.criotonmanor.com, www.ciotonmanor.com, www.crootonmanor.com, www.cootonmanor.com, www.crlotonmanor.com, www.clotonmanor.com, www.crlotonmanor.com, www.clotonmanor.com, www.cr.otonmanor.com, www.c.otonmanor.com, www.crtonmanor.com, www.crobtonmanor.com, www.crbtonmanor.com, www.crohtonmanor.com, www.crhtonmanor.com, www.crogtonmanor.com, www.crgtonmanor.com, www.crojtonmanor.com, www.crjtonmanor.com, www.cromtonmanor.com, www.crmtonmanor.com, www.cro tonmanor.com, www.cr tonmanor.com, www.crovtonmanor.com, www.crvtonmanor.com, www.croonmanor.com, www.crotqonmanor.com, www.croqonmanor.com, www.crotaonmanor.com, www.croaonmanor.com, www.crot onmanor.com, www.cro onmanor.com, www.crotwonmanor.com, www.crowonmanor.com, www.croteonmanor.com, www.croeonmanor.com, www.crotzonmanor.com, www.crozonmanor.com, www.crotxonmanor.com, www.croxonmanor.com, www.crotconmanor.com, www.croconmanor.com, www.crotnmanor.com, www.crotobnmanor.com, www.crotbnmanor.com, www.crotohnmanor.com, www.crothnmanor.com, www.crotognmanor.com, www.crotgnmanor.com, www.crotojnmanor.com, www.crotjnmanor.com, www.crotomnmanor.com, www.crotmnmanor.com, www.croto nmanor.com, www.crot nmanor.com, www.crotovnmanor.com, www.crotvnmanor.com, www.crotomanor.com, www.crotonnmanor.com, www.crotonmanor.com, www.crotonhmanor.com, www.crotohmanor.com, www.crotonjmanor.com, www.crotojmanor.com, www.crotonkmanor.com, www.crotokmanor.com, www.crotonlmanor.com, www.crotolmanor.com, www.croton manor.com, www.croto manor.com, www.crotonanor.com, www.crotonmpanor.com, www.crotonpanor.com, www.crotonmoanor.com, www.crotonoanor.com, www.crotonmianor.com, www.crotonianor.com, www.crotonmkanor.com, www.crotonkanor.com, www.crotonm.anor.com, www.croton.anor.com, www.crotonmuanor.com, www.crotonuanor.com, www.crotonmjanor.com, www.crotonjanor.com, www.crotonmnanor.com, www.crotonnanor.com, www.crotonm-anor.com, www.croton-anor.com, www.crotonmnor.com, www.crotonmaonor.com, www.crotonmonor.com, www.crotonmapnor.com, www.crotonmpnor.com, www.crotonma9nor.com, www.crotonm9nor.com, www.crotonmanor.com, www.crotonmnor.com, www.crotonmainor.com, www.crotonminor.com, www.crotonmaunor.com, www.crotonmunor.com, www.crotonmaor.com, www.crotonmannor.com, www.crotonmanor.com, www.crotonmanhor.com, www.crotonmahor.com, www.crotonmanjor.com, www.crotonmajor.com, www.crotonmankor.com, www.crotonmakor.com, www.crotonmanlor.com, www.crotonmalor.com, www.crotonman or.com, www.crotonma or.com, www.crotonmanr.com, www.crotonmanobr.com, www.crotonmanbr.com, www.crotonmanohr.com, www.crotonmanhr.com, www.crotonmanogr.com, www.crotonmangr.com, www.crotonmanojr.com, www.crotonmanjr.com, www.crotonmanomr.com, www.crotonmanmr.com, www.crotonmano r.com, www.crotonman r.com, www.crotonmanovr.com, www.crotonmanvr.com, www.crotonmano.com, www.crotonmanori.com, www.crotonmanoi.com, www.crotonmanoro.com, www.crotonmanoo.com, www.crotonmanorl.com, www.crotonmanol.com, www.crotonmanorl.com, www.crotonmanol.com, www.crotonmanor..com, www.crotonmano..com,
Other websites we recently analyzed
- www.batteriealimentatori.it
Arezzo (Italy) - 62.149.132.120
Server software: Microsoft-IIS/8.5
Technology: Html
Number of meta tags: 1 - seay.ru
Russian Federation - 89.111.167.3
Server software: nginx/0.6.32
Technology: Html
Number of meta tags: 1 - Ben Brit | Personal Blog
Scottsdale (United States) - 72.167.183.39
Server software: Apache
Technology: CSS, Html, Html5, Php, Pingback, Wordpress
Number of meta tags: 2 - PRODAJA - Pekarska i ugostiteljska oprema nova i polovna, odrzavanje i servisiranje.
Prodaja pekarske opreme nova i polovna, poslastiÄarske oprema, servisiranje i odrzavanje pekarsko ugostiteljske opreme.Sweden - 194.9.95.45
Server software: Apache/2.2.31 (FreeBSD) PHP/5.5.33 mod_ssl/2.2.31 OpenSSL/0.9.8zh-freebsd
Technology: CSS, Html, Javascript, Php
Number of Javascript: 13
Number of meta tags: 9 - IPA - Regionalni klub Karlovac - Naslovnica
policijska udrugaSan Francisco (United States) - 199.34.228.100
Server software: Apache
Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
Number of Javascript: 7
Number of meta tags: 3 - SZEOB
Hungary - 92.43.203.26
Server software: Apache
Technology: CSS, Google Font API, Html, Html5, Javascript, Php, Joomla
Number of Javascript: 18
Number of meta tags: 2 - HADI Maschinenbau GesmbH - Maschinen für die Akkumulatoren-Industrie
Maschinen für die Akkumulatoren-Industrie - Machines for the accumulator industryAustria - 213.145.228.64
Server software: Apache/1.3.34
Technology: CSS, Html, Javascript, Php, Swf Object
Number of Javascript: 1
Number of meta tags: 5 - Nicolaasparochie Amsterdam
Netherlands - 188.93.150.44
Server software: Apache/2.2.16 (Debian)
Technology: CSS, Html, Javascript, jQuery UI, Php, Facebook Box
Number of Javascript: 12
Number of meta tags: 3 - Common Thread Ministries - Home
Houston (United States) - 192.254.236.52
Server software: nginx/1.10.1
Technology: CSS, Google Font API, Html, Html5
Number of Javascript: 2
Number of meta tags: 1 - kinderopvangwatergraafsmeer.amsterdam
Netherlands - 188.93.150.35
Server software: Apache/2.4.10
Technology: Html